Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: P61885
RecName: 30S ribosomal protein S10
Begin-End: 5-99
Organism: Pyrococcus furiosus
Interaction Mode:   

Sequence:
RIKIASTNVRSLDEVANQIKQIAERTGVRMSGPIPLPTKRIRITTRKSPDGEGSATFDRW
ELRVHKRLIDIEADERAMRQIMRIRVPEDVTIEIE
Structures of the domain P61885 5-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jb3 X-ray 5.34 L 5-99 None
5jbh X-ray 5.34 L 5-99 None


© NPIDB team 2003 - 2021

text