Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: P61941
RecName: 30S ribosomal protein S12
Begin-End: 12-123
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
REKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEG
HNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPK
Structures of the domain P61941 12-123
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2r1g X-ray 12.5 H 15-126 None
4kvb X-ray 4.2 L 15-126 None


© NPIDB team 2003 - 2021

text