Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: P61992
RecName: 30S ribosomal protein S4
Begin-End: 103-152
Organism: Pyrococcus abyssi
Interaction Mode:   

Sequence:
RRLQTIVYKKGLARTMRQARQLIVHGHIEVNGQIIRSPSYLVLKEEEDTI
Structures of the domain P61992 103-152
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6sw9 X-ray 4.2 D 103-152 None
5jb3 X-ray 5.34 D 103-152 None
6swd X-ray 3.2 D 103-152 None
6swc X-ray 3.3 D 103-152 None
5jbh X-ray 5.34 D 103-152 None


© NPIDB team 2003 - 2021

text