Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: P61994
RecName: 30S ribosomal protein S12
Begin-End: 32-146
Organism: Pyrococcus abyssi
Interaction Mode:   

Sequence:
RRVLRLKEKSDPLEGAPQARGIVLEKIAVEAKQPNSGMRKAVRVQLIKNGKVVTAFCPGD
GAIKFIDEHDEVIIEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPR
Structures of the domain P61994 32-146
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6sw9 X-ray 4.2 N 32-146 None
5jb3 X-ray 5.34 N 32-146 None
6swd X-ray 3.2 N 32-146 None
6swc X-ray 3.3 N 32-146 None
5jbh X-ray 5.34 N 32-146 None


© NPIDB team 2003 - 2021

text