Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: P62128
RecName: 30S ribosomal protein S12, chloroplastic
Begin-End: 12-123
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
RQPIRNVTKSPALRGCPQRRGTCTRVYTITPKKPNSALRKVARVRLTSGFEITAYIPGIG
HNLQEHSVVLVRGGRVKDLPGVRYHIVRGTLDAVGVKDRQQGRSKYGVKKPK
Structures of the domain P62128 12-123
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8r X-ray 3.7 l 12-123 None
5mmj X-ray 3.65 l 12-123 None


© NPIDB team 2003 - 2021

text