Pfam domain
Pfam family: Ribosomal_S9 (PF00380.21)
Uniprot AC: P62249
RecName: 40S ribosomal protein S16
Begin-End: 14-129
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAGVDIRVRVK
GGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCES
Structures of the domain P62249 14-129
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6g18 X-ray 3.6 Q 14-129 None


© NPIDB team 2003 - 2021

text