Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: P62266
RecName: 40S ribosomal protein S23
Begin-End: 29-140
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPND
GCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKER
Structures of the domain P62266 29-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6zvh X-ray 2.9 X 28-142 None
6g51 X-ray 4.1 X 100-213 None
6g4w X-ray 4.5 X 100-213 None
7k5i X-ray 2.9 X 29-142 None
6zok X-ray 2.8 X 29-142 None
6zxe X-ray 3 X 29-142 None
6g53 X-ray 4.5 X 29-142 None
5a2q X-ray 3.9 X 29-142 None
6g5h X-ray 3.6 X 29-142 None
6zxd X-ray 3.2 X 29-142 None
5flx X-ray 3.9 X 29-140 None
6g4s X-ray 4 X 100-213 None
6g18 X-ray 3.6 X 100-213 None
6g5i X-ray 3.5 X 100-213 None
5oa3 X-ray 4.3 X 29-142 None
6ybw X-ray 3.1 E 29-141 None
6zmt X-ray 3 X 29-142 None
6zoj X-ray 2.8 X 29-142 None
6zn5 X-ray 3.2 X 29-142 None
4cxg X-ray 8.7 X 29-140 None
4cxh X-ray 8.9 X 29-140 None
6zlw X-ray 2.6 X 29-142 None
6zxg X-ray 2.6 X 29-140 None
6zxh X-ray 2.7 X 29-140 None
6zxf X-ray 3.7 X 29-140 None


© NPIDB team 2003 - 2021

text