Pfam domain
Pfam family: Ribosomal_L5 (PF00281.21)
Uniprot AC: P62399
RecName: 50S ribosomal protein L5
Begin-End: 24-80
Organism: Escherichia coli
Interaction Mode:   

Sequence:
SVMQVPRVEKITLNMGVGEAIADKKLLDNAAADLAAISGQKPLITKARKSVAGFKIR
Structures of the domain P62399 24-80
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5aka X-ray 5.7 F 23-79 None
6i0y X-ray 3.2 F 23-79 None
5gaf X-ray 4.3 F 24-80 None
6gbz X-ray 3.8 F 23-79 None
6gc4 X-ray 4.3 F 23-79 None
6ys3 X-ray 2.58 f 24-80 None
3j5s X-ray 7.5 G 23-79 None
3j5l X-ray 6.6 F 23-79 None
3j7z X-ray 3.9 F 23-79 None
6s0k X-ray 3.1 F 23-80 None
6gc8 X-ray 3.8 F 23-79 None
5gae X-ray 3.33 F 24-80 None
4csu X-ray 5.5 F 23-79 None
3j8g X-ray 5 F 23-79 None
7bv8 X-ray 3.14 F 24-80 None
6xz7 X-ray 2.1 F 24-80 None
5gag X-ray 3.8 F 23-80 None
5ady X-ray 4.5 F 23-79 None
4uy8 X-ray 3.8 F 23-79 None
2rdo X-ray 9.1 F 23-79 None
6gc0 X-ray 3.8 F 23-79 None
3bbx X-ray 10 F 23-79 None
2j28 X-ray 8 F 23-79 None
5gah X-ray 3.8 F 24-80 None
5gad X-ray 3.7 F 24-80 None
6qul X-ray 3 F 24-80 None
6wnt X-ray 3.1 e 23-79 None
6qdw X-ray 2.83 f 24-80 None


© NPIDB team 2003 - 2021

text