Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: P62664
RecName: 30S ribosomal protein S4
Begin-End: 99-146
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
SRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEI
Structures of the domain P62664 99-146
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kvb X-ray 4.2 D 99-146 None


© NPIDB team 2003 - 2021

text