Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: P62668
RecName: 30S ribosomal protein S8
Begin-End: 4-138
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
DPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYL
KYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDRE
ARKLGVGGELICEVW
Structures of the domain P62668 4-138
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kvb X-ray 4.2 H 4-138 None


© NPIDB team 2003 - 2021

text