Pfam domain
Pfam family: Ribosomal_S9 (PF00380.21)
Uniprot AC: P62669
RecName: 30S ribosomal protein S9
Begin-End: 8-128
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
GRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRG
GGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSK
R
Structures of the domain P62669 8-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2r1g X-ray 12.5 G 8-128 None
4kvb X-ray 4.2 I 8-128 None


© NPIDB team 2003 - 2021

text