Pfam domain
Pfam family: CENP-T_C (PF15511.8)
Uniprot AC: P62799
RecName: Histone H4
Begin-End: 26-99
Organism: Xenopus laevis
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAM
DVVYALKRQGRTLY
Structures of the domain P62799 26-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wu8 X-ray 2.45 B 25-98 None
4wu9 X-ray 2.6 B 25-98 None
6kix X-ray 4.1 B 25-98  H-Bb L-Bb 
6kix X-ray 4.1 F 26-98  H-Bb L-Bb 
3kwq X-ray 3.5 B 26-98  H-Bb S-Bb L-Bb 
3mgr X-ray 2.3 B 26-98 None
5o9g X-ray 4.8 F 26-98 None
6ryr X-ray 3.1 F 26-98 None
3mgq X-ray 2.65 B 26-98 None
2f8n X-ray 2.9 B 26-98  H-Bb S-Bb L-Bb 
6jyl X-ray 3.37 F 26-98  H-Bb S-Bb L-Bb 
5onw X-ray 2.8 B 26-98 None
3uta X-ray 2.07 B 25-98 None
5oy7 X-ray 5.77 d 29-101 None
5oy7 X-ray 5.77 F 30-102 None
5oy7 X-ray 5.77 V 26-98 None
5oy7 X-ray 5.77 N 26-98 None
5dnm X-ray 2.81 B 25-98 None
5dnn X-ray 2.8 B 25-98 None
2fj7 X-ray 3.2 B 26-98  H-Bb H-Mj S-Bb L-Bb 
6ltj X-ray 3.7 F 26-98  H-Bb 
6ltj X-ray 3.7 B 26-98  H-Bb 
3kxb X-ray 3.2 B 29-98  H-Bb 
3kuy X-ray 2.9 B 25-98 None
6px3 X-ray 4.1 F 26-98  H-Bb S-Bb L-Bb 
6px3 X-ray 4.1 B 26-98  H-Bb H-Mj S-Bb L-Bb 
3c1c X-ray 3.15 B 26-98  H-Bb S-Bb L-Bb 
4j8v X-ray 2.58 B 25-98 None
4j8v X-ray 2.58 B 25-98 None
4j8x X-ray 2.87 B 25-98 None
4j8x X-ray 2.87 B 25-98 None
3lel X-ray 2.95 B 26-98 None
3lel X-ray 2.95 L 26-98 None
1m1a X-ray 2.65 B 26-98  H-Bb H-Mj S-Bb L-Bb 
2nzd X-ray 2.65 B 25-98 None
5e5a X-ray 2.81 B 26-98  H-Bb S-Bb L-Bb 
4ys3 X-ray 3 F 226-298  H-Bb H-Mj S-Bb L-Bb 
4ys3 X-ray 3 B 26-98  H-Bb H-Mj S-Bb L-Bb 
3b6f X-ray 3.45 B 26-98 None
3b6g X-ray 3.45 B 26-98 None
3o62 X-ray 3.22 B 26-98  H-Bb S-Bb L-Bb 
3rei X-ray 2.65 B 25-98 None
5mlu X-ray 2.8 F 26-98 None
1s32 X-ray 2.05 B 25-98  H-Bb S-Bb L-Bb 
1m19 X-ray 2.3 B 26-98  H-Bb S-Bb L-Bb 
6nog X-ray 3.9 F 25-98  H-Bb S-Bb L-Bb 
6nog X-ray 3.9 B 26-98  S-Bb L-Bb 
6kiu X-ray 3.2 F 26-98  H-Bb L-Bb 
6kiu X-ray 3.2 B 25-98  H-Bb L-Bb 
3reh X-ray 2.5 B 25-98 None
5hq2 X-ray 4.5 B 26-98 None
6jm9 X-ray 7.3 B 25-98 None
3utb X-ray 2.2 F 26-98 None
3lz0 X-ray 2.5 F 26-98 None
3mgp X-ray 2.44 B 26-98 None
3rej X-ray 2.55 F 26-98 None
3rek X-ray 2.6 F 26-98 None
3rel X-ray 2.7 F 26-98 None
4xzq X-ray 2.4 F 226-298  H-Bb H-Mj S-Bb L-Bb 
4xzq X-ray 2.4 B 26-98  H-Bb H-Mj S-Bb L-Bb 
3lz1 X-ray 2.5 F 26-98 None
6esg X-ray 5.4 F 26-98 None
6esg X-ray 5.4 B 26-98 None
3ut9 X-ray 2.2 B 26-98 None
6esi X-ray 6.3 B 26-98 None
1m18 X-ray 2.45 B 26-98  H-Bb S-Bb L-Bb 
4kgc X-ray 2.69 B 25-98 None
4r8p X-ray 3.28 F 25-98 None
3c1b X-ray 2.2 B 26-98  H-Bb S-Bb L-Bb 
3lja X-ray 2.75 B 26-98 None
1zbb X-ray 9 b 25-98  H-Bb H-Mj S-Bb L-Bb 
1zbb X-ray 9 B 25-98  H-Bb H-Mj S-Bb L-Bb 
4xuj X-ray 3.18 B 25-98 None
6pa7 X-ray 2.94 B 25-98  H-Bb H-Mj S-Bb L-Bb 
5cp6 X-ray 2.6 B 25-98 None
5omx X-ray 2.32 B 26-98 None
5ong X-ray 2.8 B 26-98 None
4z66 X-ray 2.5 F 225-298  H-Bb H-Mj S-Bb L-Bb 
4z66 X-ray 2.5 B 26-98  H-Bb H-Mj S-Bb L-Bb 
6x0n X-ray 10 f 23-95 None
6x0n X-ray 10 b 26-98 None
6x0n X-ray 10 F 25-98 None
6x0n X-ray 10 B 28-101 None
5xf6 X-ray 2.63 B 25-98 None
4zux X-ray 3.82 P 26-98 None
4zux X-ray 3.82 F 11-84 None
6iy2 X-ray 3.47 F 25-98  H-Bb S-Bb L-Bb 
6uxw X-ray 8.96 W 26-98  H-Bb S-Bb L-Bb 
6r25 X-ray 4.61 B 26-98 None
6r25 X-ray 4.61 F 26-98 None
6i84 X-ray 4.4 U 26-98  H-Bb H-Mj 
5oxv X-ray 6.72 F 26-98 None
5oxv X-ray 6.72 P 26-98 None
6esh X-ray 5.1 F 25-98 None
6esh X-ray 5.1 B 25-98 None
1zla X-ray 2.9 B 26-98  H-Bb S-Bb L-Bb 
3mnn X-ray 2.5 B 25-98 None
6nn6 X-ray 3.9 B 25-98 None
6nn6 X-ray 3.9 F 26-98 None
6ven X-ray 3.37 F 25-98  H-Bb L-Bb 
6ven X-ray 3.37 B 25-98  H-Bb L-Bb 
6r1u X-ray 4.36 F 26-98 None
6kiz X-ray 4.5 F 26-98  S-Bb L-Bb 
3mgs X-ray 3.15 B 26-98 None
6t9l X-ray 3.6 F 26-98 None
6vyp X-ray 4.99 F 26-98 None
6vyp X-ray 4.99 B 25-98 None
6vyp X-ray 4.99 f 26-98 None
6vyp X-ray 4.99 b 24-96 None
1kx4 X-ray 2.6 F 26-98 None
1p34 X-ray 2.7 F 225-298  H-Bb H-Mj S-Bb L-Bb 
1p3a X-ray 3 F 225-298  H-Bb H-Mj S-Bb L-Bb 
1p3a X-ray 3 B 26-98  H-Bb S-Bb L-Bb 
1p3b X-ray 3 F 226-298  H-Bb H-Mj S-Bb L-Bb 
1p3b X-ray 3 B 27-98  H-Bb S-Bb L-Bb 
1p3f X-ray 2.9 F 226-298  H-Bb H-Mj S-Bb L-Bb 
1p3f X-ray 2.9 B 26-98  H-Bb S-Bb L-Bb 
1p3g X-ray 2.7 B 26-98  H-Bb S-Bb L-Bb 
1p3i X-ray 2.3 F 226-298  H-Bb H-Mj S-Bb L-Bb 
1p3i X-ray 2.3 B 26-98  H-Bb S-Bb L-Bb 
1p3k X-ray 2.9 B 26-98  H-Bb S-Bb L-Bb 
1p3k X-ray 2.9 F 225-298  H-Bb H-Mj S-Bb L-Bb 
1p3l X-ray 2.4 B 26-98  H-Bb S-Bb L-Bb 
1p3m X-ray 2.9 B 26-98  H-Bb S-Bb L-Bb 
1p3m X-ray 2.9 F 225-298  H-Bb H-Mj S-Bb L-Bb 
1p3o X-ray 2.75 F 226-298  H-Bb H-Mj S-Bb L-Bb 
1p3o X-ray 2.75 B 25-98  H-Bb S-Bb L-Bb 
1p3p X-ray 2.7 F 225-298  H-Bb H-Mj S-Bb L-Bb 
1p3p X-ray 2.7 B 25-98  H-Bb S-Bb L-Bb 
4j8u X-ray 2.38 B 25-98 None
6tda X-ray 15 F 25-98  H-Bb H-Mj S-Bb L-Bb 
6px1 X-ray 3.3 F 25-98  H-Bb S-Bb L-Bb 
6px1 X-ray 3.3 B 25-98  H-Bb S-Bb L-Bb 
6om3 X-ray 3.3 R 25-98  H-Bb S-Bb L-Bb 
6nqa X-ray 3.54 B 25-98  H-Bb L-Bb 
4j8w X-ray 2.41 B 25-98 None
6j99 X-ray 4.1 F 25-98  H-Bb S-Bb L-Bb 
6tem X-ray 3.9 F 26-98 None
6tem X-ray 3.9 B 26-98 None
6kiw X-ray 4 F 25-98  H-Bb S-Bb L-Bb 
6nzo X-ray 3.8 F 26-98  H-Bb S-Bb L-Bb 
6nzo X-ray 3.8 B 26-98  H-Bb H-Mj S-Bb L-Bb 
6jma X-ray 6.8 B 25-98 None
6kiv X-ray 4 F 25-98  H-Bb L-Bb 
7at8 X-ray 4.4 I 26-98 None
7at8 X-ray 4.4 E 26-98 None
6vz4 X-ray 3.9 F 27-99  H-Bb S-Bb L-Bb 
6wz9 X-ray 2.8 B 26-98 None
6wz9 X-ray 2.8 F 26-98 None
6wz5 X-ray 2.2 B 25-98 None
6wz5 X-ray 2.2 F 25-98 None


© NPIDB team 2003 - 2021

text