Pfam domain
Pfam family: CENP-T_C (PF15511.8)
Uniprot AC: P62805
RecName: Histone H4
Begin-End: 19-99
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mn L-Bb 

Sequence:
HRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAK
RKTVTAMDVVYALKRQGRTLY
Structures of the domain P62805 19-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x7x X-ray 2.18 F 23-98  H-Bb H-Mj S-Bb L-Bb 
3w98 X-ray 3.42 F 25-98  H-Bb S-Bb L-Bb 
3azl X-ray 2.7 F 23-98  H-Bb H-Mj S-Bb L-Bb 
5xf4 X-ray 2.87 F 20-98 None
2cv5 X-ray 2.5 F 24-98  H-Bb H-Mj S-Bb S-Mn L-Bb 
5cpk X-ray 2.63 F 25-98  H-Bb H-Mj S-Bb L-Bb 
5z23 X-ray 2.73 F 25-98  H-Bb H-Mj S-Bb L-Bb 
5av9 X-ray 2.2 F 23-98 None
6t7b X-ray 5.1 B 24-98  S-Bb L-Bb 
3x1s X-ray 2.81 F 25-98  H-Bb H-Mj S-Bb L-Bb 
3x1t X-ray 2.81 F 20-98  H-Bb H-Mj S-Bb L-Bb 
3x1u X-ray 3.25 F 20-98  H-Bb H-Mj S-Bb L-Bb 
3x1u X-ray 3.25 B 25-98  H-Bb H-Mj S-Bb L-Bb 
3x1v X-ray 2.92 F 20-98  H-Bb H-Mj S-Bb L-Bb 
6r8y X-ray 4.3 B 24-99  H-Bb S-Bb L-Bb 
6l9h X-ray 2.6 B 20-98 None
6se6 X-ray 3.5 F 25-98 None
6y5d X-ray 4.1 F 26-99  H-Bb S-Bb L-Bb 
6hts X-ray 4.8 N 23-98 None
6upl X-ray 7.4 F 25-98 None
7joa X-ray 3.3 F 24-98 None
6jr1 X-ray 2.4 F 23-98  H-Bb H-Mj S-Bb L-Bb 
3wtp X-ray 2.67 F 24-98  H-Bb H-Mj S-Bb L-Bb 
6k1k X-ray 2.2 B 20-98 None
3azg X-ray 2.4 F 25-98  H-Bb H-Mj S-Bb L-Bb 
7jo9 X-ray 3.3 F 24-98 None
3waa X-ray 3.2 F 25-98  H-Bb H-Mj S-Bb L-Bb 
3afa X-ray 2.5 F 25-98  H-Bb H-Mj S-Bb L-Bb 
3av1 X-ray 2.5 F 25-98  H-Bb H-Mj S-Bb L-Bb 
3azi X-ray 2.7 F 25-98  H-Bb S-Bb L-Bb 
3av2 X-ray 2.8 F 25-98  H-Bb H-Mj S-Bb L-Bb 
3azf X-ray 2.7 F 25-98  H-Bb H-Mj S-Bb L-Bb 
3aze X-ray 3 F 24-98  H-Bb S-Bb L-Bb 
3azj X-ray 2.89 F 24-98  H-Bb H-Mj S-Bb L-Bb 
3azk X-ray 3.2 F 25-98  H-Bb H-Mj S-Bb L-Bb 
3azm X-ray 2.89 F 25-98  H-Bb S-Bb L-Bb 
3ayw X-ray 2.9 F 25-98  H-Bb H-Mj S-Bb L-Bb 
3azn X-ray 3 F 25-98  H-Bb H-Mj S-Bb L-Bb 
3a6n X-ray 2.7 F 25-98  H-Bb H-Mj S-Bb L-Bb 
3azh X-ray 3.49 F 24-98  H-Bb H-Mj S-Bb L-Bb 
6kvd X-ray 2.21 F 24-98  H-Bb H-Mj S-Bb L-Bb 
6ke9 X-ray 2.22 B 20-98 None
5cpi X-ray 2.9 F 25-98  H-Bb S-Bb L-Bb 
4z5t X-ray 2.8 B 25-98  H-Bb S-Bb L-Bb 
4ym6 X-ray 3.51 F 25-98  H-Bb H-Mj S-Bb L-Bb 
3wa9 X-ray 3.07 F 25-98  H-Bb H-Mj S-Bb L-Bb 
3w96 X-ray 3 F 25-98  H-Bb 
3w97 X-ray 3.2 F 25-98  H-Bb H-Mj S-Bb L-Bb 
5xf3 X-ray 2.6 F 20-98 None
5b0y X-ray 2.56 F 25-98  H-Bb H-Mj S-Bb L-Bb 
5av6 X-ray 2.2 F 23-98 None
6jr0 X-ray 2.5 F 23-98  H-Bb H-Mj S-Bb L-Bb 
6k1j X-ray 2.85 F 20-98 None
5gtc X-ray 2.7 F 23-98  H-Bb S-Bb L-Bb 
6ipu X-ray 1.99 F 20-98 None
6t7c X-ray 4 F 20-98  H-Bb L-Bb 
6t7c X-ray 4 B 24-98  H-Bb H-Mj S-Bb L-Bb 
6t7d X-ray 4.4 F 20-98  S-Bb L-Bb 
6t7d X-ray 4.4 B 24-98  S-Bb L-Bb 
6t79 X-ray 3.2 F 20-98  H-Bb H-Mj S-Bb L-Bb 
6t79 X-ray 3.2 B 24-98  H-Bb H-Mj S-Bb L-Bb 
5b33 X-ray 2.93 F 25-98  H-Bb H-Mj S-Bb L-Bb 
6r94 X-ray 3.5 F 21-99  H-Bb S-Bb L-Bb 
6r94 X-ray 3.5 B 26-99  H-Bb S-Bb L-Bb 
5gt3 X-ray 2.91 F 24-98  H-Bb H-Mj S-Bb L-Bb 
6rny X-ray 3.9 F 25-98 None
6rny X-ray 3.9 B 25-98 None
5gxq X-ray 2.85 F 25-98  H-Bb H-Mj S-Bb L-Bb 
5av8 X-ray 2.2 F 23-98 None
7k60 X-ray 3.12 B 25-98  H-Bb S-Bb L-Bb 
7k60 X-ray 3.12 F 25-98  H-Bb S-Bb L-Bb 
5avb X-ray 2.4 F 20-98 None
5b2i X-ray 3 F 24-98 None
5b32 X-ray 2.35 F 25-98  H-Bb H-Mj S-Bb L-Bb 
5gt0 X-ray 2.82 F 23-98  H-Bb H-Mj S-Bb L-Bb 
5y0d X-ray 1.99 F 24-98  H-Bb H-Mj S-Bb L-Bb 
5avc X-ray 2.4 F 20-98 None
5xf5 X-ray 2.82 F 20-98 None
5b24 X-ray 3.6 F 25-98  H-Bb H-Mj S-Bb L-Bb 
5b31 X-ray 2.2 F 25-98  H-Bb H-Mj S-Bb L-Bb 
5jrg X-ray 2.5 F 23-98  H-Bb S-Bb L-Bb 
3w99 X-ray 3 F 25-98  H-Bb S-Bb L-Bb 
3wkj X-ray 2.8 F 25-98  H-Bb H-Mj S-Bb L-Bb 
5av5 X-ray 2.4 F 23-98 None
5y0c X-ray 2.09 F 20-98  H-Bb H-Mj S-Bb L-Bb 
6kxv X-ray 3.63 F 25-98  H-Bb H-Mj S-Bb L-Bb 
6l49 X-ray 18.9 T 25-98 None
6l49 X-ray 18.9 L 25-98 None
5z30 X-ray 2.45 F 24-98  H-Bb H-Mj S-Bb L-Bb 
5zbx X-ray 2.58 F 24-98  H-Bb H-Mj S-Bb L-Bb 
5b2j X-ray 2.6 F 24-98 None
6iq4 X-ray 2.25 F 20-98 None
6t7a X-ray 3.7 F 20-98  H-Bb L-Bb 
6t7a X-ray 3.7 B 20-98  H-Bb H-Mj S-Bb L-Bb 
5cpj X-ray 3.15 F 25-98  H-Bb H-Mj 
5gsu X-ray 3.1 F 23-98  H-Bb H-Mj S-Bb L-Bb 
6le9 X-ray 2.6 B 20-98 None
6k1i X-ray 2.75 F 20-98 None
4ym5 X-ray 4.01 F 20-98  H-Bb S-Bb L-Bb 
5b0z X-ray 1.99 F 25-98  H-Bb H-Mj S-Bb S-Mn L-Bb 
6r8z X-ray 3.9 B 24-99  H-Bb S-Bb L-Bb 
6l4a X-ray 12.3 T 25-98 None
6l4a X-ray 12.3 L 25-98 None
6l4a X-ray 12.3 B 25-98 None
6jxd X-ray 2.25 F 20-98 None
6r90 X-ray 4.5 F 21-99  H-Bb S-Bb L-Bb 
6v92 X-ray 20 f 24-98  H-Bb H-Mj S-Bb L-Bb 
6mup X-ray 3.5 F 21-98 None
6mup X-ray 3.5 B 21-98 None
6muo X-ray 3.6 B 17-98 None
6r0c X-ray 4.2 B 25-98 None
6y5e X-ray 3.15 F 26-99  H-Bb S-Bb L-Bb 
7k63 X-ray 3.03 B 25-98  H-Bb S-Bb L-Bb 
7k63 X-ray 3.03 F 25-98  H-Bb S-Bb L-Bb 
6jou X-ray 2.17 F 24-98  H-Bb H-Mj S-Bb L-Bb 
6usj X-ray 10.5 F 20-98 None
6usj X-ray 10.5 P 20-98 None
7k5x X-ray 2.93 B 25-98  H-Bb H-Mj S-Bb L-Bb 
7k5x X-ray 2.93 F 25-98  H-Bb S-Bb L-Bb 
7k61 X-ray 2.85 B 25-98  H-Bb S-Bb L-Bb 
7k61 X-ray 2.85 F 25-98  H-Bb S-Bb L-Bb 
6v2k X-ray 2.6 F 25-98  H-Bb H-Mj S-Bb L-Bb 
7c0m X-ray 3.9 B 25-98  H-Bb S-Bb L-Bb 
7c0m X-ray 3.9 b 25-98  H-Bb S-Bb L-Bb 
7k5y X-ray 2.76 B 25-98  H-Bb S-Bb L-Bb 
7k5y X-ray 2.76 F 25-98  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text