Pfam domain
Pfam family: CENP-T_C (PF15511.8)
Uniprot AC: P62805
RecName: Histone H4
Begin-End: 26-94
Organism: Homo sapiens
Interaction Mode:   

Sequence:
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAM
DVVYALKRQ
Structures of the domain P62805 26-94
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gse X-ray 3.14 L 26-93  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text