Pfam domain
Pfam family: CENP-T_C (PF15511.8)
Uniprot AC: P62806
RecName: Histone H4
Begin-End: 18-99
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA
KRKTVTAMDVVYALKRQGRTLY
Structures of the domain P62806 18-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1f66 X-ray 2.6 F 223-298  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text