Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P62807
RecName: Histone H2B type 1-C/E/F/G/I
Begin-End: 33-102
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
SRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITS
REIQTAVRLL
Structures of the domain P62807 33-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6se0 X-ray 3.8 H 31-101 None
6se0 X-ray 3.8 D 30-101 None
6se6 X-ray 3.5 H 35-101 None
6se6 X-ray 3.5 D 33-101 None
6upl X-ray 7.4 L 35-101 None
6upl X-ray 7.4 D 30-101 None
6upk X-ray 4.9 D 31-101 None
7joa X-ray 3.3 H 31-101 None
7joa X-ray 3.3 D 31-101 None
6see X-ray 4.2 H 35-101 None
6see X-ray 4.2 D 30-98 None
7jo9 X-ray 3.3 H 31-101 None
7jo9 X-ray 3.3 D 31-101 None
6sef X-ray 3.7 H 35-101 None
6sef X-ray 3.7 D 33-101 None
6xjd X-ray 6.8 H 31-101  H-Bb L-Bb 
6xjd X-ray 6.8 D 30-101  H-Bb S-Bb L-Bb L-Mn 
6rny X-ray 3.9 H 29-98 None
6rny X-ray 3.9 D 29-98 None
5gt0 X-ray 2.82 H 32-101  H-Bb S-Bb L-Bb 
5gt0 X-ray 2.82 D 28-101  H-Bb H-Mj S-Bb L-Bb L-Mn 
6fml X-ray 4.34 P 31-101 None
6fml X-ray 4.34 T 31-101 None
5kgf X-ray 4.54 H 26-98 None
6seg X-ray 3.1 H 35-101 None
6seg X-ray 3.1 D 33-101 None
6c0w X-ray 4 H 33-101 None
6c0w X-ray 4 D 33-101 None
6r0c X-ray 4.2 H 29-98 None
6r0c X-ray 4.2 D 29-98 None
6x59 X-ray 2.98 H 31-101  H-Bb S-Bb L-Bb 
6x59 X-ray 2.98 D 30-101  H-Bb S-Bb L-Bb 
6x5a X-ray 4.36 H 31-101  H-Bb S-Bb L-Bb 
6x5a X-ray 4.36 D 30-101  H-Bb S-Bb L-Bb 
7a08 X-ray 3.11 g 35-101 None
7a08 X-ray 3.11 c 32-101 None


© NPIDB team 2003 - 2021

text