Pfam domain
Pfam family: DNA_gyraseB_C (PF00986.23)
Uniprot AC: P66937
RecName: DNA gyrase subunit B
Begin-End: 572-634
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
TPKWSIARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQ
FIE
Structures of the domain P66937 572-634
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2xcr X-ray 3.5 U 572-634  H-Bb 
2xcr X-ray 3.5 S 572-634 None
2xcr X-ray 3.5 D 572-634  H-Bb H-Mj 
2xcr X-ray 3.5 B 572-634  H-Bb 


© NPIDB team 2003 - 2021

text