Pfam domain
Pfam family: DNA_gyraseB_C (PF00986.23)
Uniprot AC: P66937
RecName: DNA gyrase subunit B
Begin-End: 580-634
Organism: Staphylococcus aureus
Interaction Mode:  H-Bb L-Bb 

Sequence:
YKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIE
Structures of the domain P66937 580-634
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5npk X-ray 1.98 d 544-634 None
5npk X-ray 1.98 b 544-634 None
5npk X-ray 1.98 D 544-634 None
5npk X-ray 1.98 B 544-634 None
6fqm X-ray 3.06 D 533-636 None
6fqs X-ray 3.11 B 542-634 None
6fqs X-ray 3.11 D 544-634 None
6fqv X-ray 2.6 U 544-634  H-Bb 
6fqv X-ray 2.6 S 544-634  H-Bb 
6fqv X-ray 2.6 D 544-634  H-Bb 
6fqv X-ray 2.6 B 544-634  H-Bb 
2xcs X-ray 2.1 D 544-634  H-Bb 
2xcs X-ray 2.1 B 544-634  H-Bb 
2xct X-ray 3.35 D 544-634  H-Bb 
2xct X-ray 3.35 B 544-634 None
2xct X-ray 3.35 U 544-634  H-Bb 
2xct X-ray 3.35 S 543-634  H-Bb 
5cdm X-ray 2.5 D 544-634  H-Bb 
5cdm X-ray 2.5 B 544-634  H-Bb 
5cdn X-ray 2.79 U 544-634  H-Bb 
5cdn X-ray 2.79 S 544-634  H-Bb 
5cdn X-ray 2.79 D 545-634  H-Bb 
5cdn X-ray 2.79 B 544-634  H-Bb 
5cdo X-ray 3.15 S 544-634  H-Bb 
5cdo X-ray 3.15 U 544-634  H-Bb 
5cdo X-ray 3.15 D 544-634  H-Bb 
5cdo X-ray 3.15 B 544-634  H-Bb 
5cdp X-ray 2.45 D 544-634  H-Bb 
5cdp X-ray 2.45 B 544-634  H-Bb 
5cdq X-ray 2.95 S 544-634  H-Bb 
5cdq X-ray 2.95 U 544-634  H-Bb 
5cdq X-ray 2.95 D 544-634  H-Bb 
5cdq X-ray 2.95 B 544-634  H-Bb 
5cdr X-ray 2.65 B 544-634  H-Bb 
5cdr X-ray 2.65 D 544-634  H-Bb 
4bul X-ray 2.6 C 544-634  H-Bb 
4bul X-ray 2.6 A 544-634  H-Bb 
6qtp X-ray 2.37 B 540-634  H-Bb 
6qtp X-ray 2.37 D 544-634  H-Bb 
5npp X-ray 2.22 D 544-634 None
5npp X-ray 2.22 B 544-634 None
5iwi X-ray 1.98 D 544-634  H-Bb 
5iwi X-ray 1.98 B 544-634  H-Bb L-Bb 
5iwm X-ray 2.5 D 544-634  H-Bb 
5iwm X-ray 2.5 B 544-634  H-Bb 
6fm4 X-ray 2.7 D 544-634  H-Bb 
6fm4 X-ray 2.7 B 544-634  H-Bb 
6qtk X-ray 2.31 D 544-634  H-Bb 
6qtk X-ray 2.31 B 544-634  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text