Pfam domain
Pfam family: DNA_gyraseB_C (PF00986.23)
Uniprot AC: P66937
RecName: DNA gyrase subunit B
Begin-End: 580-634
Organism: Staphylococcus aureus
Interaction Mode:  H-Bb L-Bb 

Sequence:
YKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIE
Structures of the domain P66937 580-634
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5npk X-ray 1.98 d 580-634 None
5npk X-ray 1.98 b 580-634 None
5npk X-ray 1.98 D 580-634 None
5npk X-ray 1.98 B 580-634 None
6fqm X-ray 3.06 D 537-636 None
6fqs X-ray 3.11 B 580-634 None
6fqs X-ray 3.11 D 580-634 None
6fqv X-ray 2.6 U 580-634  H-Bb 
6fqv X-ray 2.6 S 580-634  H-Bb 
6fqv X-ray 2.6 D 580-634  H-Bb 
6fqv X-ray 2.6 B 580-634  H-Bb 
2xcs X-ray 2.1 D 580-634  H-Bb 
2xcs X-ray 2.1 B 580-634  H-Bb 
2xct X-ray 3.35 D 581-634  H-Bb 
2xct X-ray 3.35 B 580-634 None
2xct X-ray 3.35 U 581-634  H-Bb 
2xct X-ray 3.35 S 582-634  H-Bb 
5cdm X-ray 2.5 D 580-634  H-Bb 
5cdm X-ray 2.5 B 580-634  H-Bb 
5cdn X-ray 2.79 U 580-634  H-Bb 
5cdn X-ray 2.79 S 580-634  H-Bb 
5cdn X-ray 2.79 D 582-634  H-Bb 
5cdn X-ray 2.79 B 580-634  H-Bb 
5cdo X-ray 3.15 S 580-634  H-Bb 
5cdo X-ray 3.15 U 580-634  H-Bb 
5cdo X-ray 3.15 D 580-634  H-Bb 
5cdo X-ray 3.15 B 580-634  H-Bb 
5cdp X-ray 2.45 D 580-634  H-Bb 
5cdp X-ray 2.45 B 580-634  H-Bb 
5cdq X-ray 2.95 S 580-634  H-Bb 
5cdq X-ray 2.95 U 580-634  H-Bb 
5cdq X-ray 2.95 D 580-634  H-Bb 
5cdq X-ray 2.95 B 580-634  H-Bb 
5cdr X-ray 2.65 B 580-634  H-Bb 
5cdr X-ray 2.65 D 580-634  H-Bb 
4bul X-ray 2.6 C 580-634  H-Bb 
4bul X-ray 2.6 A 580-634  H-Bb 
6qtp X-ray 2.37 B 580-634  H-Bb 
6qtp X-ray 2.37 D 580-634  H-Bb 
5npp X-ray 2.22 D 580-634 None
5npp X-ray 2.22 B 580-634 None
5iwi X-ray 1.98 D 580-634  H-Bb 
5iwi X-ray 1.98 B 580-634  H-Bb L-Bb 
5iwm X-ray 2.5 D 580-634  H-Bb 
5iwm X-ray 2.5 B 580-634  H-Bb 
6fm4 X-ray 2.7 D 580-634  H-Bb 
6fm4 X-ray 2.7 B 580-634  H-Bb 
6qtk X-ray 2.31 D 580-634  H-Bb 
6qtk X-ray 2.31 B 580-634  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text