Pfam domain
Pfam family: DNA_gyraseB_C (PF00986.23)
Uniprot AC: P66937
RecName: DNA gyrase subunit B
Begin-End: 592-634
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
WETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIE
Structures of the domain P66937 592-634
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fqm X-ray 3.06 b 535-634 None
6fqm X-ray 3.06 B 538-631 None


© NPIDB team 2003 - 2021

text