Pfam domain
Pfam family: Penicillinase_R (PF03965.18)
Uniprot AC: P68261
RecName: Methicillin resistance regulatory protein MecI
Begin-End: 8-122
Organism: Staphylococcus aureus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
ISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIF
QYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNK
Structures of the domain P68261 8-122
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2d45 X-ray 3.8 A 8-121  H-Bb H-Mj L-Bb 
2d45 X-ray 3.8 B 8-121  H-Bb H-Mj L-Bb 
2d45 X-ray 3.8 D 8-121  H-Bb H-Mj L-Bb 
2d45 X-ray 3.8 C 8-121  H-Bb H-Mj L-Bb 
1sax X-ray 2.8 B 8-122  H-Bb H-Mj S-Bb 
1sax X-ray 2.8 A 8-122  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text