Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P68431
RecName: Histone H3.1
Begin-End: 39-132
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 

Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACE
AYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P68431 39-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3w98 X-ray 3.42 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3w98 X-ray 3.42 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azl X-ray 2.7 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azl X-ray 2.7 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5xf4 X-ray 2.87 A 38-131 None
5xf4 X-ray 2.87 E 38-131 None
2cv5 X-ray 2.5 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
2cv5 X-ray 2.5 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5cpk X-ray 2.63 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5cpk X-ray 2.63 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5z23 X-ray 2.73 E 38-133  H-Bb H-Mj S-Bb L-Bb L-Mn 
5z23 X-ray 2.73 A 38-133  H-Bb H-Mj S-Bb L-Bb L-Mn 
5av9 X-ray 2.2 E 37-131 None
5av9 X-ray 2.2 A 37-131 None
3x1s X-ray 2.81 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3x1s X-ray 2.81 A 39-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3x1t X-ray 2.81 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3x1t X-ray 2.81 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3x1u X-ray 3.25 E 37-131  H-Bb H-Mj S-Bb L-Bb 
3x1u X-ray 3.25 A 38-131  H-Bb H-Mj S-Bb L-Bb 
3x1v X-ray 2.92 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3x1v X-ray 2.92 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6r8y X-ray 4.3 A 36-132  H-Bb H-Mj S-Bb L-Bb 
6r8y X-ray 4.3 E 36-132  H-Bb S-Bb L-Bb 
6l9h X-ray 2.6 E 40-131 None
6l9h X-ray 2.6 A 40-131 None
6hts X-ray 4.8 M 37-131 None
6hts X-ray 4.8 I 40-131 None
6upl X-ray 7.4 E 37-131 None
6upl X-ray 7.4 A 38-131 None
6t93 X-ray 3.49 E 39-132  H-Bb H-Mj S-Bb L-Bb 
6t93 X-ray 3.49 A 39-132  H-Bb S-Bb L-Bb L-Mn 
6upk X-ray 4.9 E 38-131 None
6jr1 X-ray 2.4 E 37-131  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 
6jr1 X-ray 2.4 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6k1k X-ray 2.2 E 38-131 None
6k1k X-ray 2.2 A 38-131 None
3azg X-ray 2.4 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azg X-ray 2.4 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3waa X-ray 3.2 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3waa X-ray 3.2 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3afa X-ray 2.5 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3afa X-ray 2.5 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azi X-ray 2.7 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azi X-ray 2.7 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azf X-ray 2.7 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azf X-ray 2.7 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3aze X-ray 3 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3aze X-ray 3 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azj X-ray 2.89 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azj X-ray 2.89 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azk X-ray 3.2 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azk X-ray 3.2 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azm X-ray 2.89 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azm X-ray 2.89 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3ayw X-ray 2.9 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3ayw X-ray 2.9 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azn X-ray 3 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azn X-ray 3 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azh X-ray 3.49 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azh X-ray 3.49 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6kvd X-ray 2.21 E 36-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6kvd X-ray 2.21 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6ke9 X-ray 2.22 A 40-131 None
6ke9 X-ray 2.22 E 40-131 None
5cpi X-ray 2.9 E 38-131  H-Bb S-Bb L-Bb 
5cpi X-ray 2.9 A 38-131  H-Bb H-Mj S-Bb L-Bb 
4ym6 X-ray 3.51 E 37-131  H-Bb H-Mj S-Bb L-Bb 
4ym6 X-ray 3.51 A 38-131  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 
3wa9 X-ray 3.07 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3wa9 X-ray 3.07 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3w96 X-ray 3 E 38-131  H-Bb H-Mj L-Bb 
3w96 X-ray 3 A 39-131  H-Bb H-Mj 
6hkt X-ray 9.7 A 38-131  H-Bb H-Mj S-Bb L-Bb 
6hkt X-ray 9.7 u 38-131  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 Y 38-131  H-Bb S-Bb L-Bb L-Mn 
6hkt X-ray 9.7 U 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6hkt X-ray 9.7 o 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6hkt X-ray 9.7 k 38-131  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 K 38-131  H-Bb H-Mj S-Bb L-Bb 
6hkt X-ray 9.7 y 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6hkt X-ray 9.7 O 38-131  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 e 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6hkt X-ray 9.7 a 38-131  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 E 38-131  H-Bb S-Bb L-Bb L-Mn 
3w97 X-ray 3.2 E 37-131  H-Bb H-Mj S-Bb L-Bb 
3w97 X-ray 3.2 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5xf3 X-ray 2.6 E 38-131 None
5xf3 X-ray 2.6 A 38-131 None
5av6 X-ray 2.2 A 37-131 None
5av6 X-ray 2.2 E 37-131 None
6jr0 X-ray 2.5 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6jr0 X-ray 2.5 E 37-131  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 
6k1j X-ray 2.85 E 38-131 None
6k1j X-ray 2.85 A 38-131 None
5gse X-ray 3.14 O 39-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5gse X-ray 3.14 E 38-131  H-Bb H-Mj S-Bb L-Bb 
5gse X-ray 3.14 A 39-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5gtc X-ray 2.7 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5gtc X-ray 2.7 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6ipu X-ray 1.99 A 38-131 None
6ipu X-ray 1.99 E 38-131 None
6r94 X-ray 3.5 E 36-132  H-Bb H-Mj S-Bb L-Bb L-Mn 
6r94 X-ray 3.5 A 36-132  H-Bb H-Mj S-Bb L-Bb 
5gt3 X-ray 2.91 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5gt3 X-ray 2.91 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5av8 X-ray 2.2 E 37-131 None
5av8 X-ray 2.2 A 37-131 None
7k60 X-ray 3.12 A 37-131  H-Bb H-Mj S-Bb L-Bb 
7k60 X-ray 3.12 E 37-131  H-Bb H-Mj S-Bb L-Bb 
5avb X-ray 2.4 E 37-131 None
5avb X-ray 2.4 A 37-131 None
5b2i X-ray 3 E 37-131 None
5b2i X-ray 3 A 37-131 None
5gt0 X-ray 2.82 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5gt0 X-ray 2.82 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5y0d X-ray 1.99 E 36-131  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 
5y0d X-ray 1.99 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5avc X-ray 2.4 E 37-131 None
5avc X-ray 2.4 A 37-131 None
5xf5 X-ray 2.82 A 38-131 None
5xf5 X-ray 2.82 E 38-131 None
5b24 X-ray 3.6 E 37-131  H-Bb H-Mj S-Bb L-Bb 
5b24 X-ray 3.6 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b31 X-ray 2.2 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b31 X-ray 2.2 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6m3v X-ray 4.6 O 38-131  H-Bb H-Mj L-Bb L-Mn 
6m3v X-ray 4.6 K 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6m3v X-ray 4.6 E 38-131  H-Bb S-Bb L-Bb 
6m3v X-ray 4.6 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5jrg X-ray 2.5 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5jrg X-ray 2.5 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3w99 X-ray 3 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3w99 X-ray 3 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3wkj X-ray 2.8 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3wkj X-ray 2.8 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5av5 X-ray 2.4 E 37-131 None
5av5 X-ray 2.4 A 37-131 None
6yov X-ray 3.42 E 40-132  H-Bb H-Mj S-Bb L-Bb 
6yov X-ray 3.42 A 40-132  H-Bb H-Mj S-Bb L-Bb 
5y0c X-ray 2.09 E 36-131  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 
5y0c X-ray 2.09 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6l49 X-ray 18.9 O 39-131 None
6l49 X-ray 18.9 K 38-131 None
6l49 X-ray 18.9 W 39-131 None
6l49 X-ray 18.9 S 38-131 None
5z30 X-ray 2.45 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5z30 X-ray 2.45 E 36-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5zbx X-ray 2.58 E 35-133  H-Bb H-Mj S-Bb L-Bb L-Mn 
5zbx X-ray 2.58 A 38-133  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b2j X-ray 2.6 E 37-131 None
5b2j X-ray 2.6 A 37-131 None
6iq4 X-ray 2.25 E 38-131 None
6iq4 X-ray 2.25 A 38-131 None
5cpj X-ray 3.15 E 38-131  H-Bb H-Mj 
5cpj X-ray 3.15 A 41-131 None
5gsu X-ray 3.1 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5gsu X-ray 3.1 E 37-131  H-Bb H-Mj S-Bb L-Bb 
6le9 X-ray 2.6 E 40-131 None
6le9 X-ray 2.6 A 40-131 None
6k1i X-ray 2.75 E 38-131 None
6k1i X-ray 2.75 A 38-131 None
7ccr X-ray 4.9 E 38-131 None
7ccr X-ray 4.9 A 40-131 None
7ccr X-ray 4.9 L 40-131 None
7ccr X-ray 4.9 P 38-131 None
4ym5 X-ray 4.01 E 38-131  H-Bb H-Mj S-Bb L-Bb 
4ym5 X-ray 4.01 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6r8z X-ray 3.9 E 36-132  H-Bb S-Bb L-Bb 
6r8z X-ray 3.9 A 36-132  H-Bb H-Mj S-Bb L-Bb 
6l4a X-ray 12.3 W 39-131 None
6l4a X-ray 12.3 S 38-131 None
6l4a X-ray 12.3 O 39-131 None
6l4a X-ray 12.3 K 38-131 None
6l4a X-ray 12.3 E 39-131 None
6l4a X-ray 12.3 A 38-131 None
6jxd X-ray 2.25 E 38-131 None
6jxd X-ray 2.25 A 38-131 None
6r90 X-ray 4.5 E 37-132  H-Bb H-Mj S-Bb L-Bb L-Mn 
6r90 X-ray 4.5 A 39-132  H-Bb H-Mj S-Bb L-Bb 
6v92 X-ray 20 e 316-410 None
6v92 X-ray 20 a 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6r93 X-ray 4 E 38-132  H-Bb H-Mj S-Bb L-Bb 
6r93 X-ray 4 A 38-132  H-Bb H-Mj S-Bb L-Bb 
6t90 X-ray 3.05 E 40-132  H-Bb H-Mj S-Bb L-Bb 
6t90 X-ray 3.05 A 41-132  H-Bb H-Mj S-Bb L-Bb L-Mn 
6r92 X-ray 4.8 A 39-132  H-Bb H-Mj S-Bb L-Bb 
6r92 X-ray 4.8 E 39-132  H-Bb H-Mj S-Bb L-Bb 
6r91 X-ray 4.1 E 39-132  H-Bb H-Mj L-Bb 
6r91 X-ray 4.1 A 36-132  H-Bb H-Mj S-Bb S-Mn L-Bb 
7ccq X-ray 3.8 E 38-131 None
7ccq X-ray 3.8 A 40-131 None
6la8 X-ray 3.4 O 38-131  H-Bb H-Mj S-Bb L-Bb 
6la8 X-ray 3.4 K 37-131  H-Bb S-Bb L-Bb 
6la8 X-ray 3.4 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6la8 X-ray 3.4 A 36-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6la9 X-ray 3.7 K 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6la9 X-ray 3.7 E 38-131  H-Bb H-Mj S-Bb L-Bb 
6la9 X-ray 3.7 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6la9 X-ray 3.7 O 38-131  H-Bb H-Mj S-Bb L-Bb 
7k63 X-ray 3.03 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
7k63 X-ray 3.03 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6jou X-ray 2.17 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6jou X-ray 2.17 E 36-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6usj X-ray 10.5 A 38-131 None
6usj X-ray 10.5 E 36-131 None
6usj X-ray 10.5 K 38-131 None
6usj X-ray 10.5 O 36-131 None
7k5x X-ray 2.93 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
7k5x X-ray 2.93 E 37-131  H-Bb S-Bb L-Bb L-Mn 
6m44 X-ray 3.81 A 38-131  H-Bb H-Mj S-Bb L-Bb 
6m44 X-ray 3.81 E 38-131  H-Bb S-Bb L-Bb L-Mn 
6m44 X-ray 3.81 K 38-131  H-Bb S-Bb L-Bb L-Mj L-Mn 
6m44 X-ray 3.81 O 37-131  H-Bb S-Bb L-Bb L-Mj 
7k61 X-ray 2.85 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
7k61 X-ray 2.85 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6v2k X-ray 2.6 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6v2k X-ray 2.6 E 36-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
7c0m X-ray 3.9 A 38-131  H-Bb S-Bb L-Bb 
7c0m X-ray 3.9 E 39-131  H-Bb H-Mj S-Bb L-Bb 
7c0m X-ray 3.9 a 38-131  H-Bb S-Bb L-Bb 
7c0m X-ray 3.9 e 39-131  H-Bb H-Mj S-Bb L-Bb 
7k5y X-ray 2.76 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
7k5y X-ray 2.76 E 37-131  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text