Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P68431
RecName: Histone H3.1
Begin-End: 60-132
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVT
IMPKDIQLARRIR
Structures of the domain P68431 60-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6upk X-ray 4.9 A 59-131 None
6m4h X-ray 3.9 A 60-131  H-Bb H-Mj S-Bb L-Bb 
6m4h X-ray 3.9 E 60-131  H-Bb H-Mj S-Bb 
6m4g X-ray 2.8 E 60-131  H-Bb H-Mj S-Bb L-Bb 
6m4g X-ray 2.8 A 60-131  H-Bb H-Mj S-Bb L-Bb 
6m4d X-ray 4.4 E 59-131  H-Bb H-Mj S-Bb L-Bb 
6m4d X-ray 4.4 A 59-131  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text