Pfam domain
Pfam family: HTH_3 (PF01381.24)
Uniprot AC: P69202
RecName: Repressor protein C2
Begin-End: 10-64
Organism: Salmonella phage P22
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
IRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYL
Structures of the domain P69202 10-64
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jxc X-ray 1.9 R 10-64  H-Bb H-Mj L-Bb L-Mj 
3jxc X-ray 1.9 L 10-64  H-Bb H-Mj L-Bb L-Mj 
3jxd X-ray 2.1 L 10-64  H-Bb H-Mj L-Bb L-Mj 
3jxd X-ray 2.1 R 10-64  H-Bb H-Mj L-Bb L-Mj 
3jxb X-ray 1.67 D 10-64  H-Bb H-Mj L-Bb L-Mj 
3jxb X-ray 1.67 C 10-64  H-Bb H-Mj L-Bb L-Mj 
2r1j X-ray 1.53 R 10-64  H-Bb H-Mj L-Bb L-Mj 
2r1j X-ray 1.53 L 10-64  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text