Pfam domain
Pfam family: DNA_topoisoIV (PF00521.22)
Uniprot AC: P72525
RecName: DNA topoisomerase 4 subunit A
Begin-End: 25-265
Organism: Streptococcus pneumoniae serotype 4
Interaction Mode:   

Sequence:
IQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSSIYDA
MVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWN
FDDTEKEPTVLPAAFPNLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKL
MEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRSKTEIEKLKGGKEQIVIIEIPYEIN
K
Structures of the domain P72525 25-265
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3foe X-ray 4 A 28-311  H-Bb H-Mj L-Bb 
3fof X-ray 4 A 28-311  H-Mj L-Bb 


© NPIDB team 2003 - 2021

text