Pfam domain
Pfam family: DNA_topoisoIV (PF00521.22)
Uniprot AC: P72525
RecName: DNA topoisomerase 4 subunit A
Begin-End: 260-422
Organism: Streptococcus pneumoniae serotype 4
Interaction Mode:   

Sequence:
PYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYT
DLQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLI
RVISILDEVIALIRASENKADAKENLKVSYDFTEEQAEAIVTL
Structures of the domain P72525 260-422
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3foe X-ray 4 A 301-468 None
3fof X-ray 4 A 300-468 None


© NPIDB team 2003 - 2021

text