Pfam domain
Pfam family: DNA_topoisoIV (PF00521.22)
Uniprot AC: P72525
RecName: DNA topoisomerase 4 subunit A
Begin-End: 28-468
Organism: Streptococcus pneumoniae serotype 4
Interaction Mode:  H-Bb L-Bb L-Mj L-Mn 

Sequence:
RALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSSIYDAMVR
MSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDD
TEKEPTVLPAAFPNLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEF
LPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRSKTEIEKLKGGKEQIVIIEIPYEINKAN
LVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTDLQINYNF
NMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDE
VIALIRASENKADAKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIA
MLAAIIGDERTMYNLMKKELR
Structures of the domain P72525 28-468
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3foe X-ray 4 B 28-467  H-Bb H-Mj L-Bb 
3ksb X-ray 3.5 B 28-467  H-Bb S-Bb S-Mj S-Mn L-Bb 
3ksb X-ray 3.5 A 28-467  H-Bb S-Bb S-Mj S-Mn L-Bb 
3ksa X-ray 3.3 B 28-467  H-Bb L-Bb L-Mj L-Mn 
3ksa X-ray 3.3 A 28-467  H-Bb L-Bb L-Mj L-Mn 
3k9f X-ray 2.9 A 28-467  H-Bb L-Bb L-Mj L-Mn 
3k9f X-ray 2.9 B 28-467  H-Bb L-Bb L-Mj L-Mn 
3fof X-ray 4 B 28-467  H-Bb H-Mj L-Bb 
3ltn X-ray 3.1 B 28-467  H-Bb H-Mj L-Bb L-Mj L-Mn 
3ltn X-ray 3.1 A 28-467  H-Bb L-Bb L-Mj L-Mn 
4koe X-ray 3.02 A 28-467  H-Bb L-Bb L-Mj L-Mn 
4koe X-ray 3.02 B 28-467  H-Bb L-Bb L-Mj L-Mn 
4kpf X-ray 3.24 A 28-467  H-Bb L-Bb L-Mj L-Mn 
4kpf X-ray 3.24 B 28-467  H-Bb L-Bb L-Mj L-Mn 
3rad X-ray 3.35 B 28-467  H-Bb L-Bb L-Mj L-Mn 
3rad X-ray 3.35 A 28-467  H-Bb L-Bb L-Mj L-Mn 
3raf X-ray 3.24 B 28-467  H-Bb S-Bb L-Bb L-Mj L-Mn 
3raf X-ray 3.24 A 28-467  H-Bb L-Bb L-Mj L-Mn 
4juo X-ray 6.53 A 28-467  H-Bb L-Bb L-Mj L-Mn 
4z3o X-ray 3.44 B 1028-1467  H-Bb L-Bb L-Mj L-Mn 
4z3o X-ray 3.44 A 1028-1467  H-Bb S-Bb L-Bb L-Mj L-Mn 
3rae X-ray 2.9 A 28-467  H-Bb L-Bb L-Mj L-Mn 
3rae X-ray 2.9 B 28-467  H-Bb L-Bb L-Mj L-Mn 
4z4q X-ray 3.04 A 1028-1467  H-Bb S-Bb L-Bb L-Mj L-Mn 
4z4q X-ray 3.04 B 1028-1467  H-Bb S-Bb L-Bb L-Mj L-Mn 
4z53 X-ray 3.26 A 1028-1467  H-Bb S-Bb L-Bb L-Mj L-Mn 
4z53 X-ray 3.26 B 1028-1467  H-Bb S-Bb L-Bb L-Mj L-Mn 
4i3h X-ray 3.7 B 1028-1467  H-Bb L-Bb L-Mj L-Mn 
4i3h X-ray 3.7 A 1028-1467  H-Bb L-Bb L-Mj L-Mn 
4kpe X-ray 3.43 A 28-467  H-Bb L-Bb L-Mj L-Mn 
4kpe X-ray 3.43 B 28-467  H-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text