Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.21)
Uniprot AC: P77933
RecName: DNA polymerase
Begin-End: 20-131
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
KKENGEFKIEYDRTFEPYFYALLKDDSAIEEVKKITAERHGTVVTVKRVEKVQKKFLGRP
VEVWKLYFTHPQDVPAIRDKIREHPAVIDIYEYDIPFAKRYLIDKGLVPMEG
Structures of the domain P77933 20-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5omf X-ray 2.09 A 20-131 None
4k8z X-ray 2.29 A 20-131 None
6q4t X-ray 2 A 20-131 None


© NPIDB team 2003 - 2021

text