Pfam domain
Pfam family: NUC194 (PF08163.14)
Uniprot AC: P78527
RecName: DNA-dependent protein kinase catalytic subunit
Begin-End: 1816-2202
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RQSFVDRSLLTLLWHCSLDALREFFSTIVVDAIDVLKSRFTKLNESTFDTQITKKMGYYK
ILDVMYSRLPKDDVHAKESKINQVFHGSCITEGNELTKTLIKLCYDAFTENMAGENQLLE
RRRLYHCAAYNCAISVICCVFNELKFYQGFLFSEKPEKNLLIFENLIDLKRRYNFPVEVE
VPMERKKKYIEIRKEAREAANGDSDGPSYMSSLSYLADSTLSEEMSQFDFSTGVQSYSYS
SQDPRPATGRFRRREQRDPTVHDDVLELEMDELNRHECMAPLTALVKHMHRSLGPPQGEE
DSVPRDLPSWMKFLHGKLGNPIVPLNIRLFLAKLVINTEEVFRPYAKHWLSPLLQLAASE
NNGGEGIHYMVVEIVATILSWTGLATP
Structures of the domain P78527 1816-2202
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5y3r X-ray 6.6 C 1760-2202 None


© NPIDB team 2003 - 2021

text