Pfam domain
Pfam family: PI3_PI4_kinase (PF00454.29)
Uniprot AC: P78527
RecName: DNA-dependent protein kinase catalytic subunit
Begin-End: 3747-4015
Organism: Homo sapiens
Interaction Mode:   

Sequence:
EHPFLVKGGEDLRQDQRVEQLFQVMNGILAQDSACSQRALQLRTYSVVPMTSRLGLIEWL
ENTVTLKDLLLNTMSQEEKAAYLSDPRAPPCEYKDWLTKMSGKHDVGAYMLMYKGANRTE
TVTSFRKRESKVPADLLKRAFVRMSTSPEAFLALRSHFASSHALICISHWILGIGDRHLN
NFMVAMETGGVIGIDFGHAFGSATQFLPVPELMPFRLTRQFINLMLPMKETGLMYSIMVH
ALRAFRSDPGLLTNTMDVFVKEPSFDWKN
Structures of the domain P78527 3747-4015
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6zhe X-ray 7.24 A 3749-4014 None
6zhe X-ray 7.24 F 3749-4014 None
5y3r X-ray 6.6 C 3749-4014 None
6zh8 X-ray 4.14 A 3749-4014 None
6zha X-ray 3.91 A 3749-4014 None


© NPIDB team 2003 - 2021

text