Pfam domain
Pfam family: zf-C4 (PF00105.20)
Uniprot AC: P79269
RecName: Glucocorticoid receptor
Begin-End: 420-488
Organism: Saguinus oedipus
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb 

Sequence:
LCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYR
KCLQAGMNL
Structures of the domain P79269 420-488
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bse X-ray 2.35 A 419-488  H-Bb H-Mj S-Bb S-Mj L-Bb 
6bse X-ray 2.35 B 419-488  H-Bb H-Mj 
6bsf X-ray 2.4 B 419-488  H-Bb H-Mj S-Bb L-Bb 
6bsf X-ray 2.4 A 419-488  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text