Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: P82162
RecName: 30S ribosomal protein S10 alpha, chloroplastic
Begin-End: 100-194
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
RIKLRSYWVPLIEDSCKQIMDAARTTNAKIMGPVPLPTKKRIYCVLKSPHVHKDARFHFE
IRTHQRLIDILYPTAQTIDSLMQLDLPAGVDVEVK
Structures of the domain P82162 100-194
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8r X-ray 3.7 j 100-194 None
5mmj X-ray 3.65 j 100-194 None


© NPIDB team 2003 - 2021

text