Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: P82670
RecName: 28S ribosomal protein S10, mitochondrial
Begin-End: 77-173
Organism: Bos taurus
Interaction Mode:   

Sequence:
SVLVKGHDKAVLDSYEYFAVLAAKELGISVKVHEPPRKIERFTLLKSVHIFKKHRVQYEM
RTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVT
Structures of the domain P82670 77-173
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6nf8 X-ray 3.48 J 77-173 None
6neq X-ray 3.32 J 77-173 None
3jd5 X-ray 7 J 77-173 None


© NPIDB team 2003 - 2021

text