Pfam domain
Pfam family: CENP-T_C (PF15511.8)
Uniprot AC: P84040
RecName: Histone H4
Begin-End: 18-99
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA
KRKTVTAMDVVYALKRQGRTLY
Structures of the domain P84040 18-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2nqb X-ray 2.3 F 223-298  H-Bb H-Mj S-Bb L-Bb 
2pyo X-ray 2.43 F 19-98 None
6pwf X-ray 4.07 B 19-98 None


© NPIDB team 2003 - 2021

text