Pfam domain
Pfam family: CENP-T_C (PF15511.8)
Uniprot AC: P84040
RecName: Histone H4
Begin-End: 23-99
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTV
TAMDVVYALKRQGRTLY
Structures of the domain P84040 23-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2nqb X-ray 2.3 B 25-98  H-Bb S-Bb L-Bb 
2pyo X-ray 2.43 B 26-98 None
5wcu X-ray 5.53 L 26-98  S-Bb L-Bb 
5wcu X-ray 5.53 P 25-98  H-Bb H-Mj S-Bb S-Mn L-Bb 
5wcu X-ray 5.53 F 25-98  H-Bb H-Mj S-Bb L-Bb 
5wcu X-ray 5.53 B 26-98  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 B 26-98  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 F 26-98  H-Bb H-Mj S-Bb L-Bb 
4x23 X-ray 3.5 P 26-98  H-Bb H-Mj S-Bb L-Bb 
4x23 X-ray 3.5 L 26-98  H-Bb S-Bb L-Bb 
4qlc X-ray 3.5 F 26-98  H-Bb H-Mj S-Bb L-Bb 
4qlc X-ray 3.5 B 26-98  H-Bb H-Mj S-Bb L-Bb 
6dzt X-ray 2.99 F 25-98  H-Bb S-Bb L-Bb 
6dzt X-ray 2.99 B 24-98  H-Bb S-Bb L-Bb 
6pwe X-ray 3.95 F 26-98 None
6pwe X-ray 3.95 B 26-98 None
6pwf X-ray 4.07 F 26-98 None


© NPIDB team 2003 - 2021

text