Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P84051
RecName: Histone H2A
Begin-End: 14-90
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
AKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDN
KKTRIIPRHLQLAIRND
Structures of the domain P84051 14-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2nqb X-ray 2.3 G 1014-1090  H-Bb S-Bb L-Bb 
2nqb X-ray 2.3 C 814-890  H-Bb S-Bb L-Bb 
2pyo X-ray 2.43 G 11-89 None
2pyo X-ray 2.43 C 13-89 None
5wcu X-ray 5.53 Q 16-90  H-Bb S-Bb S-Mn L-Bb 
5wcu X-ray 5.53 M 15-90  S-Bb L-Bb 
5wcu X-ray 5.53 G 16-90  H-Bb S-Bb 
5wcu X-ray 5.53 C 15-90  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 G 15-89  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 C 15-89  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 Q 15-89  H-Bb S-Bb S-Mn L-Bb 
4x23 X-ray 3.5 M 15-89  H-Bb S-Bb L-Bb 
4qlc X-ray 3.5 G 13-89  H-Bb S-Bb L-Bb 
4qlc X-ray 3.5 C 14-89  H-Bb S-Bb L-Bb 
6dzt X-ray 2.99 G 14-90  H-Bb S-Bb L-Bb 
6dzt X-ray 2.99 C 13-90  H-Bb S-Bb L-Bb 
6pwe X-ray 3.95 C 14-89 None
6pwe X-ray 3.95 G 14-89 None
6pwf X-ray 4.07 G 14-89 None
6pwf X-ray 4.07 C 14-89 None


© NPIDB team 2003 - 2021

text