Pfam domain
Pfam family: H2TH (PF06831.16)
Uniprot AC: P84131
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 134-214
Organism: Geobacillus stearothermophilus
Interaction Mode:  H-Bb L-Bb 

Sequence:
LGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAA
SLSSKEIERLHEEMVATIGEA
Structures of the domain P84131 134-214
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3gq3 X-ray 1.83 A 134-240  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text