Pfam domain
Pfam family: H2TH (PF06831.16)
Uniprot AC: P84131
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 134-220
Organism: Geobacillus stearothermophilus
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
LGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAA
SLSSKEIERLHEEMVATIGEAVMKGGS
Structures of the domain P84131 134-220
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2f5p X-ray 2 A 134-241  H-Bb L-Bb 
1l1t X-ray 1.8 A 134-238  H-Bb 
3sav X-ray 2.13 A 134-240  H-Bb H-Mj L-Bb 
1l2b X-ray 2.4 A 134-234  H-Bb 
3sar X-ray 1.95 A 134-241  H-Bb H-Mj L-Bb 
3sbj X-ray 2.1 A 134-240  H-Bb H-Mj L-Bb 
3go8 X-ray 1.89 A 134-240  H-Bb L-Bb L-Mj 
3u6p X-ray 1.6 A 134-240  L-Bb 
1l1z X-ray 1.7 A 134-236  H-Bb 
1l2c X-ray 2.2 A 134-238  H-Bb 
2f5o X-ray 2.05 A 134-240  H-Bb L-Bb 
3gpu X-ray 1.62 A 134-244  H-Bb L-Bb L-Mj 
4g4n X-ray 1.85 A 134-241  H-Bb L-Bb 
3u6l X-ray 1.97 A 134-240  H-Bb L-Bb 
3sas X-ray 2.05 A 134-241  H-Bb L-Bb 
4g4r X-ray 1.95 A 134-240  H-Bb L-Bb 
4g4q X-ray 1.86 A 134-241  H-Bb L-Bb 
3u6s X-ray 1.77 A 134-240  H-Bb L-Bb 
3u6q X-ray 1.98 A 134-240  H-Bb L-Bb 
4g4o X-ray 1.95 A 134-240  H-Bb L-Bb 
3u6c X-ray 1.8 A 134-240  L-Bb 
3gq5 X-ray 1.9 A 134-240  H-Bb L-Bb 
3u6o X-ray 1.9 A 134-240  H-Bb L-Bb 
3u6e X-ray 1.7 A 134-240  L-Bb 
3u6m X-ray 2.1 A 134-240 None
3u6d X-ray 1.87 A 134-240  H-Bb L-Bb 
3sat X-ray 2.15 A 134-244  L-Bb 
3gpx X-ray 1.78 A 134-240  H-Bb L-Bb L-Mj 
2f5n X-ray 2 A 134-240  L-Bb 
3jr4 X-ray 2.6 A 134-236 None
3gpp X-ray 2.15 A 134-244  H-Bb L-Bb L-Mj 
3gp1 X-ray 2.05 A 134-240  H-Bb L-Bb L-Mj 
3sau X-ray 1.65 A 134-244  H-Bb L-Bb 
3saw X-ray 2.35 A 134-240  L-Bb 


© NPIDB team 2003 - 2021

text