Pfam domain
Pfam family: H2TH (PF06831.16)
Uniprot AC: P84131
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 134-226
Organism: Geobacillus stearothermophilus
Interaction Mode:  H-Bb L-Bb L-Mn 

Sequence:
LGPEPLSPAFSPAVLAERAVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAA
SLSSKEIERLHEEMVATIGEAVMKGGSTVRTYV
Structures of the domain P84131 134-226
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1r2z X-ray 1.63 A 134-226  H-Bb L-Bb 
2f5q X-ray 2.35 A 134-226  H-Bb L-Mn 
1r2y X-ray 2.34 A 134-226  H-Bb L-Bb L-Mn 
2f5s X-ray 2.35 A 134-226  H-Bb L-Bb 
3jr5 X-ray 1.7 A 134-226  H-Bb L-Bb 
3gq4 X-ray 1.7 A 134-226  H-Bb L-Bb 
3gpy X-ray 1.85 A 134-226  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text