Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P84233
RecName: Histone H3.2
Begin-End: 23-132
Organism: Xenopus laevis
Interaction Mode:   

Sequence:
TKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTD
LRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P84233 23-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7at8 X-ray 4.4 D 22-131 None


© NPIDB team 2003 - 2021

text