Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P84233
RecName: Histone H3.2
Begin-End: 43-132
Organism: Xenopus laevis
Interaction Mode:   

Sequence:
RPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLV
GLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P84233 43-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3kxb X-ray 3.2 A 42-131  H-Bb H-Mj 
3kxb X-ray 3.2 E 45-131  H-Bb H-Mj 
4ld9 X-ray 3.31 E 44-131 None
6esg X-ray 5.4 E 42-131 None
6vyp X-ray 4.99 a 3-115 None


© NPIDB team 2003 - 2021

text