Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P84243
RecName: Histone H3.3
Begin-End: 39-132
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 

Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASE
AYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P84243 39-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x7x X-ray 2.18 E 36-131  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 
5x7x X-ray 2.18 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6j4y X-ray 4.3 e 39-131 None
6j4y X-ray 4.3 a 2-95 None
6a5r X-ray 8.7 e 2-94 None
6a5r X-ray 8.7 a 2-95 None
6j4z X-ray 4.1 a 38-131 None
6j4z X-ray 4.1 e 2-94 None
3wtp X-ray 2.67 E 36-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3av2 X-ray 2.8 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3av2 X-ray 2.8 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6j4w X-ray 7.9 a 2-95 None
6j4w X-ray 7.9 e 39-131 None
5b33 X-ray 2.93 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b33 X-ray 2.93 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6rny X-ray 3.9 A 39-131 None
6rny X-ray 3.9 E 39-131 None
5b32 X-ray 2.35 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b32 X-ray 2.35 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6inq X-ray 6.9 e 2-94 None
6inq X-ray 6.9 a 38-131 None
6a5o X-ray 9.9 a 38-131 None
6a5o X-ray 9.9 e 2-94 None
6a5u X-ray 7.6 a 2-95 None
6a5u X-ray 7.6 e 39-131 None
6a5p X-ray 7 e 39-131 None
6a5p X-ray 7 a 38-131 None
6j4x X-ray 4.3 a 2-95 None
6j4x X-ray 4.3 e 2-94 None
6j51 X-ray 4.2 a 38-131 None
6j51 X-ray 4.2 e 2-94 None
6a5l X-ray 5.6 a 2-95 None
6a5l X-ray 5.6 e 39-131 None
6j50 X-ray 4.7 e 39-131 None
6j50 X-ray 4.7 a 2-95 None
6ir9 X-ray 3.8 e 2-94 None
6ir9 X-ray 3.8 a 38-131 None
6a5t X-ray 6.7 a 38-131 None
6a5t X-ray 6.7 e 2-94 None
6r0c X-ray 4.2 E 39-131 None
6r0c X-ray 4.2 A 39-131 None
7a08 X-ray 3.11 d 40-131 None


© NPIDB team 2003 - 2021

text