Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: P96856
RecName: HTH-type transcriptional repressor KstR
Begin-End: 42-88
Organism: Mycobacterium tuberculosis
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
ILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSA
Structures of the domain P96856 42-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ua1 X-ray 2.9 A 21-67 None
5ua1 X-ray 2.9 B 21-67 None
5ua1 X-ray 2.9 B 21-67  H-Bb H-Mj L-Bb L-Mj 
5ua1 X-ray 2.9 A 21-67  H-Bb H-Mj L-Bb L-Mj 
5fmp X-ray 2.26 B 42-88  H-Bb H-Mj L-Bb L-Mj 
5fmp X-ray 2.26 A 42-88  H-Bb H-Mj L-Bb L-Mj 
5ua2 X-ray 2.9 A 42-88 None


© NPIDB team 2003 - 2021

text