Pfam domain
Pfam family: Fer4_16 (PF13484.8)
Uniprot AC: P97030
RecName: Epoxyqueuosine reductase
Begin-End: 186-249
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
DMCGSCTKCLDACPTGALVNPGQLNAQRCISFLTQTKGFLPDEFRTKIGNRLYGCDTCQT
VCPL
Structures of the domain P97030 186-249
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5d0b X-ray 2.65 A 187-250 None
5d0b X-ray 2.65 B 187-250 None
5t8y X-ray 2.65 A 187-250 None
5t8y X-ray 2.65 B 187-250 None
5d0a X-ray 2.1 A 187-250 None
5d0a X-ray 2.1 B 187-250 None
5d0a X-ray 2.1 C 187-250 None
5d0a X-ray 2.1 D 187-250 None


© NPIDB team 2003 - 2021

text