Pfam domain
Pfam family: HEAT_2 (PF13646.8)
Uniprot AC: P97030
RecName: Epoxyqueuosine reductase
Begin-End: 299-370
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
PIQRNAILALAHFKDASALPELTELMHKDPRPVIRGTAAWAIGKIGDPAYAEELEKALEK
EKDEEAKLEIEK
Structures of the domain P97030 299-370
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5d0b X-ray 2.65 A 300-371 None
5d0b X-ray 2.65 B 300-371 None
5t8y X-ray 2.65 A 300-371 None
5t8y X-ray 2.65 B 300-371 None
5d0a X-ray 2.1 A 300-371 None
5d0a X-ray 2.1 B 300-371 None
5d0a X-ray 2.1 C 300-371 None
5d0a X-ray 2.1 D 300-371 None


© NPIDB team 2003 - 2021

text