Pfam domain
Pfam family: DUF1730 (PF08331.12)
Uniprot AC: P97030
RecName: Epoxyqueuosine reductase
Begin-End: 57-135
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
RVTPKLLLPKAKSIVAIALAYPSRMKDAPRSTRTERRGIFCRASWGKDYHDVLREKLDLL
EDFLKSKHEDIRTKSMVDT
Structures of the domain P97030 57-135
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5d0b X-ray 2.65 A 57-135 None
5d0b X-ray 2.65 B 57-135 None
5t8y X-ray 2.65 A 57-135 None
5t8y X-ray 2.65 B 57-136 None
5d0a X-ray 2.1 A 57-135 None
5d0a X-ray 2.1 B 57-135 None
5d0a X-ray 2.1 C 57-135 None
5d0a X-ray 2.1 D 57-135 None


© NPIDB team 2003 - 2021

text