Pfam domain
Pfam family: Ets (PF00178.24)
Uniprot AC: P97360
RecName: Transcription factor ETV6
Begin-End: 336-416
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
LLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALR
HYYKLNIIRKEPGQRLLFRFM
Structures of the domain P97360 336-416
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4mhg X-ray 2.2 A 336-416  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text