Pfam domain
Pfam family: Toprim (PF01751.24)
Uniprot AC: P9WG49
RecName: DNA topoisomerase 1
Begin-End: 19-141
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
RLVIVESPTKARKLASYLGSGYIVESSRGHIRDLPRAASDVPAKYKSQPWARLGVNVDAD
FEPLYIISPEKRSTVSELRGLLKDVDELYLATDGDREGEAIAWHLLETLKPRIPVKRMVF
HEI
Structures of the domain P9WG49 19-141
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6cqi X-ray 2.42 A 19-141 None
6cq2 X-ray 3 A 19-141 None


© NPIDB team 2003 - 2021

text