Pfam domain
Pfam family: Sigma70_r4 (PF04545.18)
Uniprot AC: P9WGH5
RecName: ECF RNA polymerase sigma factor SigL
Begin-End: 119-168
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
ALAQLSAEHRAVIQRSYYRGWSTAQIATDLGIAEGTVKSRLHYAVRALRL
Structures of the domain P9WGH5 119-168
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tyf X-ray 3.8 F 119-168 None
6dve X-ray 3.81 F 119-168 None
6dv9 X-ray 3.8 F 119-168 None
6tyg X-ray 3.5 F 119-168 None
6tye X-ray 3.79 F 119-168 None
6dvc X-ray 3.3 F 119-168 None
6dvb X-ray 3.8 F 119-168 None
6dvd X-ray 3.9 F 119-168 None


© NPIDB team 2003 - 2021

text