Pfam domain
Pfam family: Sigma70_r2 (PF04542.16)
Uniprot AC: P9WGH5
RecName: ECF RNA polymerase sigma factor SigL
Begin-End: 18-87
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
LYDEHAAVLWRYALRLTGDAAQAEDVVQETLLRAWQHPEVIGDTARPARAWLFTVARNMI
IDERRSARFR
Structures of the domain P9WGH5 18-87
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tyf X-ray 3.8 F 18-87 None
6dve X-ray 3.81 F 18-87 None
6dv9 X-ray 3.8 F 18-87 None
6tyg X-ray 3.5 F 18-102 None
6tye X-ray 3.79 F 18-87 None
6dvc X-ray 3.3 F 18-87 None
6dvb X-ray 3.8 F 18-87 None
6dvd X-ray 3.9 F 18-87 None


© NPIDB team 2003 - 2021

text