Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: P9WGY5
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 42-105
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
ELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVGPLVEPGLQEKPLSIALREIHA
DLLE
Structures of the domain P9WGY5 42-105
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uhf X-ray 4.35 E 42-105 None
6vw0 X-ray 3.59 E 42-105 None
5uhb X-ray 4.29 E 42-105 None
6vvx X-ray 3.39 E 42-105 None
5uh8 X-ray 4.18 E 42-105 None
5uh5 X-ray 3.75 E 42-105 None
6jcy X-ray 3.11 E 41-104 None
5uha X-ray 3.91 E 42-105 None
6c04 X-ray 3.27 E 42-105 None
6koq X-ray 3.35 E 41-104 None
6tyf X-ray 3.8 E 42-105 None
6eec X-ray 3.55 E 42-105 None
6dve X-ray 3.81 E 42-105 None
6dv9 X-ray 3.8 E 42-105 None
5uh9 X-ray 4.4 E 42-105 None
5zx2 X-ray 2.8 E 41-104 None
6tyg X-ray 3.5 E 42-105 None
6kop X-ray 3.3 E 41-104 None
6m7j X-ray 4.4 E 42-105 None
6koo X-ray 2.8 E 41-104 None
6tye X-ray 3.79 E 42-105 None
5uhd X-ray 4.01 E 42-105 None
6edt X-ray 0 E 42-105 None
5uh6 X-ray 3.84 E 42-105 None
6dvc X-ray 3.3 E 42-105 None
5uhe X-ray 4.04 E 42-105 None
6bzo X-ray 3.38 E 42-105 None
5uhg X-ray 3.97 E 42-105 None
5uhc X-ray 3.8 E 42-105 None
6kon X-ray 3 E 41-104 None
6ee8 X-ray 3.92 E 42-105 None
6jcx X-ray 2.9 E 41-104 None
6dvb X-ray 3.8 E 42-105 None
6dvd X-ray 3.9 E 42-105 None
6vvy X-ray 3.42 E 42-105 None
6vvz X-ray 3.72 E 42-105 None


© NPIDB team 2003 - 2021

text